PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G038400.1
Common NamePHAVU_008G038400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 210aa    MW: 24104.2 Da    PI: 7.8261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G038400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161057148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++ Edell+ +v+++G g W +++++ g++R+ k+c++rw++yl
  Phvul.008G038400.1 10 KGAWSKFEDELLKACVHLHGEGKWYLVPQRAGLNRCQKSCRLRWLNYL 57
                        79********************************************97 PP

2Myb_DNA-binding491.4e-1563107147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg ++++E +l ++++k+lG++ W++Ia +++ gRt +++k++w++y
  Phvul.008G038400.1  63 RGDFSEDEIDLMIRLHKLLGNR-WSLIAGRLP-GRTSNDVKNYWNTY 107
                         899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.01557IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-21660IPR009057Homeodomain-like
SuperFamilySSF466897.35E-277104IPR009057Homeodomain-like
SMARTSM007174.5E-12959IPR001005SANT/Myb domain
PfamPF002496.1E-151057IPR001005SANT/Myb domain
CDDcd001679.58E-81257No hitNo description
PROSITE profilePS5129422.95658112IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2361112IPR009057Homeodomain-like
SMARTSM007174.4E-1462110IPR001005SANT/Myb domain
PfamPF002493.1E-1463107IPR001005SANT/Myb domain
CDDcd001679.73E-1066107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEGSSSGVRK GAWSKFEDEL LKACVHLHGE GKWYLVPQRA GLNRCQKSCR LRWLNYLKPN  60
IKRGDFSEDE IDLMIRLHKL LGNRWSLIAG RLPGRTSNDV KNYWNTYTRR KLHSQNRVKQ  120
STSKTCPNLL QGEFINTSKV GVSKEGAAAS SNWWETLCDE NITVNNTCFF GEEDAVFDEL  180
WNQQLTSIDS HFLTEAETWS QIFLDLEIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9342805e-44AB934280.1 Glycine max gene for MYB transcription factor, complete cds, allele: R, cultivar: Clark.
GenBankAB9342815e-44AB934281.1 Glycine max gene for MYB transcription factor, complete cds, allele: r-m.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139538.11e-155hypothetical protein PHAVU_008G038400g
SwissprotQ9FNV83e-53MY114_ARATH; Transcription factor MYB114
SwissprotQ9FNV97e-53MY113_ARATH; Transcription factor MYB113
TrEMBLV7B0V21e-155V7B0V2_PHAVU; Uncharacterized protein
STRINGGLYMA09G36983.12e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66380.12e-54myb domain protein 114